Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PIP5K2A monoclonal antibody (M01), clone 3A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about PIP5K2A monoclonal antibody (M01), clone 3A3
| Brand: | Abnova |
| Reference: | H00005305-M01 |
| Product name: | PIP5K2A monoclonal antibody (M01), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIP5K2A. |
| Clone: | 3A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5305 |
| Gene name: | PIP4K2A |
| Gene alias: | FLJ13267|PI5P4KA|PIP5K2A|PIP5KII-alpha|PIP5KIIA|PIPK |
| Gene description: | phosphatidylinositol-5-phosphate 4-kinase, type II, alpha |
| Genbank accession: | NM_005028 |
| Immunogen: | PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD |
| Protein accession: | NP_005019 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PIP5K2A monoclonal antibody (M01), clone 3A3 Western Blot analysis of PIP5K2A expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |