| Brand: | Abnova |
| Reference: | H00005305-A01 |
| Product name: | PIP5K2A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PIP5K2A. |
| Gene id: | 5305 |
| Gene name: | PIP4K2A |
| Gene alias: | FLJ13267|PI5P4KA|PIP5K2A|PIP5KII-alpha|PIP5KIIA|PIPK |
| Gene description: | phosphatidylinositol-5-phosphate 4-kinase, type II, alpha |
| Genbank accession: | NM_005028 |
| Immunogen: | PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD |
| Protein accession: | NP_005019 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |