View larger

PIN4 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PIN4 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00005303-A01
Product name:	PIN4 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PIN4.
Gene id:	5303
Gene name:	PIN4
Gene alias:	EPVH\|MGC138486\|PAR14\|PAR17
Gene description:	protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
Genbank accession:	NM_006223
Immunogen:	PIN4 (NP_006214, 61 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Protein accession:	NP_006214
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.67 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice