Brand: | Abnova |
Reference: | H00005303-A01 |
Product name: | PIN4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PIN4. |
Gene id: | 5303 |
Gene name: | PIN4 |
Gene alias: | EPVH|MGC138486|PAR14|PAR17 |
Gene description: | protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) |
Genbank accession: | NM_006223 |
Immunogen: | PIN4 (NP_006214, 61 a.a. ~ 156 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
Protein accession: | NP_006214 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |