| Brand: | Abnova |
| Reference: | H00005295-A01 |
| Product name: | PIK3R1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PIK3R1. |
| Gene id: | 5295 |
| Gene name: | PIK3R1 |
| Gene alias: | GRB1|p85|p85-ALPHA |
| Gene description: | phosphoinositide-3-kinase, regulatory subunit 1 (alpha) |
| Genbank accession: | NM_181504 |
| Immunogen: | PIK3R1 (NP_852556, 251 a.a. ~ 360 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN |
| Protein accession: | NP_852556 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |