| Brand: | Abnova |
| Reference: | H00005291-M01 |
| Product name: | PIK3CB monoclonal antibody (M01), clone 4H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3CB. |
| Clone: | 4H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5291 |
| Gene name: | PIK3CB |
| Gene alias: | DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA |
| Gene description: | phosphoinositide-3-kinase, catalytic, beta polypeptide |
| Genbank accession: | NM_006219 |
| Immunogen: | PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY |
| Protein accession: | NP_006210 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PIK3CB on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |