No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re,PLA-Ce |
Brand: | Abnova |
Reference: | H00005291-M01 |
Product name: | PIK3CB monoclonal antibody (M01), clone 4H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3CB. |
Clone: | 4H2 |
Isotype: | IgG2a Kappa |
Gene id: | 5291 |
Gene name: | PIK3CB |
Gene alias: | DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA |
Gene description: | phosphoinositide-3-kinase, catalytic, beta polypeptide |
Genbank accession: | NM_006219 |
Immunogen: | PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY |
Protein accession: | NP_006210 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to PIK3CB on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |