No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,PLA-Ce |
Brand: | Abnova |
Reference: | H00005290-M01 |
Product name: | PIK3CA monoclonal antibody (M01), clone 3G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3CA. |
Clone: | 3G3 |
Isotype: | IgG1 Kappa |
Gene id: | 5290 |
Gene name: | PIK3CA |
Gene alias: | MGC142161|MGC142163|PI3K|p110-alpha |
Gene description: | phosphoinositide-3-kinase, catalytic, alpha polypeptide |
Genbank accession: | NM_006218 |
Immunogen: | PIK3CA (NP_006209, 959 a.a. ~ 1068 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN |
Protein accession: | NP_006209 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PIK3CA is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |