Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PIK3C2A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PIK3C2A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005286-A01 |
| Product name: | PIK3C2A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PIK3C2A. |
| Gene id: | 5286 |
| Gene name: | PIK3C2A |
| Gene alias: | CPK|DKFZp686L193|MGC142218|PI3-K-C2(ALPHA)|PI3-K-C2A |
| Gene description: | phosphoinositide-3-kinase, class 2, alpha polypeptide |
| Genbank accession: | NM_002645 |
| Immunogen: | PIK3C2A (NP_002636, 1577 a.a. ~ 1686 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL |
| Protein accession: | NP_002636 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | The SH3 domain of postsynaptic density 95 mediates inflammatory pain through phosphatidylinositol-3-kinase recruitment.Arbuckle MI, Komiyama NH, Delaney A, Coba M, Garry EM, Rosie R, Allchorne AJ, Forsyth LH, Bence M, Carlisle HJ, O'Dell TJ, Mitchell R, Fleetwood-Walker SM, Grant SG. EMBO Rep. 2010 Jun;11(6):473-8. Epub 2010 May 14. |