SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P) View larger

SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005271-D01P
Product name: SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SERPINB8 protein.
Gene id: 5271
Gene name: SERPINB8
Gene alias: CAP2|PI8
Gene description: serpin peptidase inhibitor, clade B (ovalbumin), member 8
Genbank accession: NM_001031848.1
Immunogen: SERPINB8 (NP_001027018.1, 1 a.a. ~ 242 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Protein accession: NP_001027018.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005271-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SERPINB8 expression in transfected 293T cell line (H00005271-T01) by SERPINB8 MaxPab polyclonal antibody.

Lane 1: SERPINB8 transfected lysate(27.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart