PI3 purified MaxPab mouse polyclonal antibody (B01P) View larger

PI3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PI3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PI3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005266-B01P
Product name: PI3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PI3 protein.
Gene id: 5266
Gene name: PI3
Gene alias: ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin
Gene description: peptidase inhibitor 3, skin-derived
Genbank accession: NM_002638.2
Immunogen: PI3 (NP_002629.1, 1 a.a. ~ 117 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Protein accession: NP_002629.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005266-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PI3 expression in transfected 293T cell line (H00005266-T01) by PI3 MaxPab polyclonal antibody.

Lane 1: PI3 transfected lysate(12.87 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PI3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart