Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PHKA2 monoclonal antibody (M04), clone 3H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA |
More info about PHKA2 monoclonal antibody (M04), clone 3H3
| Brand: | Abnova |
| Reference: | H00005256-M04 |
| Product name: | PHKA2 monoclonal antibody (M04), clone 3H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PHKA2. |
| Clone: | 3H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5256 |
| Gene name: | PHKA2 |
| Gene alias: | GSD9A|MGC133071|PHK|PYK|PYKL|XLG|XLG2 |
| Gene description: | phosphorylase kinase, alpha 2 (liver) |
| Genbank accession: | NM_000292 |
| Immunogen: | PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
| Protein accession: | NP_000283 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PHKA2 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA |
| Shipping condition: | Dry Ice |