Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PHKA2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PHKA2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005256-A01 |
| Product name: | PHKA2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PHKA2. |
| Gene id: | 5256 |
| Gene name: | PHKA2 |
| Gene alias: | GSD9A|MGC133071|PHK|PYK|PYKL|XLG|XLG2 |
| Gene description: | phosphorylase kinase, alpha 2 (liver) |
| Genbank accession: | NM_000292 |
| Immunogen: | PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
| Protein accession: | NP_000283 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Somatostatin receptor subtype-2-deficient mice with diet-induced obesity have hyperglycemia, nonfasting hyperglucagonemia, and decreased hepatic glycogen deposition.Singh V, Grotzinger C, Nowak KW, Zacharias S, Goncz E, Pless G, Sauer IM, Eichhorn I, Pfeiffer-Guglielmi B, Hamprecht B, Wiedenmann B, Plockinger U, Strowski MZ. Endocrinology. 2007 Aug;148(8):3887-99. Epub 2007 May 24. |