Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of PHKA1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PHKA1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005255-A01 |
| Product name: | PHKA1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PHKA1. |
| Gene id: | 5255 |
| Gene name: | PHKA1 |
| Gene alias: | MGC132604|PHKA |
| Gene description: | phosphorylase kinase, alpha 1 (muscle) |
| Genbank accession: | NM_002637 |
| Immunogen: | PHKA1 (NP_002628, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSF |
| Protein accession: | NP_002628 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A kinome-targeted RNAi-based screen links FGF signaling to H2AX phosphorylation in response to radiation.Benzina S, Pitaval A, Lemercier C, Lustremant C, Frouin V, Wu N, Papine A, Soussaline F, Romeo PH, Gidrol X. Cell Mol Life Sci. 2015 Apr 18. [Epub ahead of print] |