Brand: | Abnova |
Reference: | H00005253-M02A |
Product name: | PHF2 monoclonal antibody (M02A), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHF2. |
Clone: | 3E7 |
Isotype: | IgM Kappa |
Gene id: | 5253 |
Gene name: | PHF2 |
Gene alias: | GRC5|JHDM1E|KIAA0662|MGC176680 |
Gene description: | PHD finger protein 2 |
Genbank accession: | NM_005392 |
Immunogen: | PHF2 (NP_005383, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS |
Protein accession: | NP_005383 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |