Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PHB monoclonal antibody (M01), clone 3F4-2B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PHB monoclonal antibody (M01), clone 3F4-2B2
| Brand: | Abnova |
| Reference: | H00005245-M01 |
| Product name: | PHB monoclonal antibody (M01), clone 3F4-2B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PHB. |
| Clone: | 3F4-2B2 |
| Isotype: | IgG2a kappa |
| Gene id: | 5245 |
| Gene name: | PHB |
| Gene alias: | PHB1 |
| Gene description: | prohibitin |
| Genbank accession: | BC013401 |
| Immunogen: | PHB (AAH13401, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
| Protein accession: | AAH13401 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (55.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Gonad differential proteins revealed with proteomics in oyster (Saccostrea cucullata) using alga as food contaminated with cadmium.Zhu B, Gao KS, Wang KJ, Ke CH, Huang HQ. Chemosphere. 2012 Jan 7. [Epub ahead of print] |