Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ABCB1 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about ABCB1 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00005243-Q01 |
| Product name: | ABCB1 (Human) Recombinant Protein (Q01) |
| Product description: | Human ABCB1 partial ORF ( NP_000918, 620 a.a. - 709 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 5243 |
| Gene name: | ABCB1 |
| Gene alias: | ABC20|CD243|CLCS|GP170|MDR1|MGC163296|P-GP|PGY1 |
| Gene description: | ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
| Genbank accession: | NM_000927 |
| Immunogen sequence/protein sequence: | GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP |
| Protein accession: | NP_000918 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative Atlas of Membrane Transporter Proteins: Development and Application of a Highly Sensitive Simultaneous LC/MS/MS Method Combined with Novel In-silico Peptide Selection Criteria.Kamiie J, Ohtsuki S, Iwase R, Ohmine K, Katsukura Y, Yanai K, Sekine Y, Uchida Y, Ito S, Terasaki T. Pharm Res. 2008 Jun;25(6):1469-83. |