Brand: | Abnova |
Reference: | H00005241-M07 |
Product name: | PGR monoclonal antibody (M07), clone 5D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody. |
Clone: | 5D10 |
Isotype: | IgG1 Kappa |
Gene id: | 5241 |
Gene name: | PGR |
Gene alias: | NR3C3|PR |
Gene description: | progesterone receptor |
Genbank accession: | NM_000926 |
Immunogen: | PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL |
Protein accession: | NP_000917 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | In Silico Prediction for Regulation of Transcription Factors onTheir Shared Target Genes Indicates Relevant Clinical Implications in a Breast Cancer Population.Liu LY, Chang LY, Kuo WH, Hwa HL, Shyu MK, Chang KJ, Hsieh FJ. Cancer Inform. 2012;11:113-37. Epub 2012 Apr 19. |