No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00005241-M01 |
| Product name: | PGR monoclonal antibody (M01), clone 3E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody. |
| Clone: | 3E11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5241 |
| Gene name: | PGR |
| Gene alias: | NR3C3|PR |
| Gene description: | progesterone receptor |
| Genbank accession: | NM_000926 |
| Immunogen: | PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL |
| Protein accession: | NP_000917 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |