PGR polyclonal antibody (A01) View larger

PGR polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGR polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PGR polyclonal antibody (A01)

Brand: Abnova
Reference: H00005241-A01
Product name: PGR polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen correspond to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
Gene id: 5241
Gene name: PGR
Gene alias: NR3C3|PR
Gene description: progesterone receptor
Genbank accession: NM_000926
Immunogen: PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Protein accession: NP_000917
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005241-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGR polyclonal antibody (A01) now

Add to cart