PGK2 polyclonal antibody (A01) View larger

PGK2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGK2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PGK2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005232-A01
Product name: PGK2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PGK2.
Gene id: 5232
Gene name: PGK2
Gene alias: PGK-2|PGKB|PGKPS|dJ417L20.2
Gene description: phosphoglycerate kinase 2
Genbank accession: NM_138733
Immunogen: PGK2 (NP_620061, 268 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
Protein accession: NP_620061
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005232-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005232-A01-1-25-1.jpg
Application image note: PGK2 polyclonal antibody (A01), Lot # 051219JCO1 Western Blot analysis of PGK2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGK2 polyclonal antibody (A01) now

Add to cart