PGK1 polyclonal antibody (A01) View larger

PGK1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGK1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PGK1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005230-A01
Product name: PGK1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PGK1.
Gene id: 5230
Gene name: PGK1
Gene alias: MGC117307|MGC142128|MGC8947|MIG10|PGKA
Gene description: phosphoglycerate kinase 1
Genbank accession: NM_000291
Immunogen: PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Protein accession: NP_000282
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005230-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005230-A01-1-22-1.jpg
Application image note: PGK1 polyclonal antibody (A01), Lot # 060927JCS1 Western Blot analysis of PGK1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGK1 polyclonal antibody (A01) now

Add to cart