| Brand: | Abnova |
| Reference: | H00005229-A01 |
| Product name: | PGGT1B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PGGT1B. |
| Gene id: | 5229 |
| Gene name: | PGGT1B |
| Gene alias: | BGGI|GGTI |
| Gene description: | protein geranylgeranyltransferase type I, beta subunit |
| Genbank accession: | NM_005023 |
| Immunogen: | PGGT1B (NP_005014, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF |
| Protein accession: | NP_005014 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TDP-43 depletion induces neuronal cell damage through dysregulation of Rho family GTPases.Iguchi Y, Katsuno M, Niwa J, Yamada S, Sone J, Waza M, Adachi H, Tanaka F, Nagata K, Arimura N, Watanabe T, Kaibuchi K, Sobue G. J Biol Chem. 2009 Aug 14;284(33):22059-66. Epub 2009 Jun 17. |