Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PGF (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about PGF (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00005228-Q01 |
| Product name: | PGF (Human) Recombinant Protein (Q01) |
| Product description: | Human PGF partial ORF ( AAH01422, 27 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 5228 |
| Gene name: | PGF |
| Gene alias: | D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760 |
| Gene description: | placental growth factor |
| Genbank accession: | BC001422 |
| Immunogen sequence/protein sequence: | WALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHV |
| Protein accession: | AAH01422 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The regulation of epithelial cell proliferation and growth by IL-1 receptor antagonist.Kondo M, Yamato M, Takagi R, Namiki H, Okano T. Biomaterials. 2013 Jan;34(1):121-9. doi: 10.1016/j.biomaterials.2012.09.036. Epub 2012 Oct 8. |