PGF purified MaxPab mouse polyclonal antibody (B01P) View larger

PGF purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGF purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about PGF purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005228-B01P
Product name: PGF purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PGF protein.
Gene id: 5228
Gene name: PGF
Gene alias: D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene description: placental growth factor
Genbank accession: NM_002632
Immunogen: PGF (NP_002623.2, 1 a.a. ~ 170 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Protein accession: NP_002623.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005228-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PGF expression in transfected 293T cell line (H00005228-T01) by PGF MaxPab polyclonal antibody.

Lane 1: PGF transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PGF purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart