PFN2 monoclonal antibody (M04), clone 5F11 View larger

PFN2 monoclonal antibody (M04), clone 5F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PFN2 monoclonal antibody (M04), clone 5F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PFN2 monoclonal antibody (M04), clone 5F11

Brand: Abnova
Reference: H00005217-M04
Product name: PFN2 monoclonal antibody (M04), clone 5F11
Product description: Mouse monoclonal antibody raised against a partial recombinant PFN2.
Clone: 5F11
Isotype: IgG2a Kappa
Gene id: 5217
Gene name: PFN2
Gene alias: D3S1319E|PFL
Gene description: profilin 2
Genbank accession: NM_002628
Immunogen: PFN2 (NP_002619, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
Protein accession: NP_002619
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005217-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005217-M04-1-1-1.jpg
Application image note: PFN2 monoclonal antibody (M04), clone 5F11 Western Blot analysis of PFN2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PFN2 monoclonal antibody (M04), clone 5F11 now

Add to cart