Brand: | Abnova |
Reference: | H00005217-M04 |
Product name: | PFN2 monoclonal antibody (M04), clone 5F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PFN2. |
Clone: | 5F11 |
Isotype: | IgG2a Kappa |
Gene id: | 5217 |
Gene name: | PFN2 |
Gene alias: | D3S1319E|PFL |
Gene description: | profilin 2 |
Genbank accession: | NM_002628 |
Immunogen: | PFN2 (NP_002619, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV |
Protein accession: | NP_002619 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PFN2 monoclonal antibody (M04), clone 5F11 Western Blot analysis of PFN2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |