No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005216-A01 |
Product name: | PFN1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant PFN1. |
Gene id: | 5216 |
Gene name: | PFN1 |
Gene alias: | - |
Gene description: | profilin 1 |
Genbank accession: | BC006768 |
Immunogen: | PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
Protein accession: | AAH06768 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1 Western Blot analysis of PFN1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |