View larger

ATP8B1 monoclonal antibody (M02), clone 3F10

Reference:

Condition: New product

Data sheet of ATP8B1 monoclonal antibody (M02), clone 3F10

Brand:	Abnova
Reference:	H00005205-M02
Product name:	ATP8B1 monoclonal antibody (M02), clone 3F10
Product description:	Mouse monoclonal antibody raised against a partial recombinant ATP8B1.
Clone:	3F10
Isotype:	IgG1 Kappa
Gene id:	5205
Gene name:	ATP8B1
Gene alias:	ATPIC\|BRIC\|FIC1\|PFIC\|PFIC1
Gene description:	ATPase, class I, type 8B, member 1
Genbank accession:	NM_005603
Immunogen:	ATP8B1 (NP_005594.1, 471 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
Protein accession:	NP_005594.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged ATP8B1 is 1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice