| Brand: | Abnova |
| Reference: | H00005205-M02 |
| Product name: | ATP8B1 monoclonal antibody (M02), clone 3F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP8B1. |
| Clone: | 3F10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5205 |
| Gene name: | ATP8B1 |
| Gene alias: | ATPIC|BRIC|FIC1|PFIC|PFIC1 |
| Gene description: | ATPase, class I, type 8B, member 1 |
| Genbank accession: | NM_005603 |
| Immunogen: | ATP8B1 (NP_005594.1, 471 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA |
| Protein accession: | NP_005594.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ATP8B1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |