Brand: | Abnova |
Reference: | H00005204-B03 |
Product name: | PFDN5 MaxPab mouse polyclonal antibody (B03) |
Product description: | Mouse polyclonal antibody raised against a full-length human PFDN5 protein. |
Gene id: | 5204 |
Gene name: | PFDN5 |
Gene alias: | MGC5329|MGC71907|MM-1|MM1|PFD5 |
Gene description: | prefoldin subunit 5 |
Genbank accession: | BC003373 |
Immunogen: | PFDN5 (-, 1 a.a. ~ 154 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA |
Protein accession: | - |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PFDN5 MaxPab polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |