Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of PFDN5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PFDN5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005204-A01 |
| Product name: | PFDN5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PFDN5. |
| Gene id: | 5204 |
| Gene name: | PFDN5 |
| Gene alias: | MGC5329|MGC71907|MM-1|MM1|PFD5 |
| Gene description: | prefoldin subunit 5 |
| Genbank accession: | NM_002624 |
| Immunogen: | PFDN5 (NP_002615, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKI |
| Protein accession: | NP_002615 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PFDN5 polyclonal antibody (A01), Lot # 050927JC01 Western Blot analysis of PFDN5 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Negative regulation of the Wnt signal by MM-1 through inhibiting expression of the wnt4 gene.Yoshida T, Kitaura H, Hagio Y, Sato T, Iguchi-Ariga SM, Ariga H. Exp Cell Res. 2008 Apr 1;314(6):1217-28. Epub 2008 Jan 12. |