| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005203-M03 |
| Product name: | PFDN4 monoclonal antibody (M03), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PFDN4. |
| Clone: | 2G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5203 |
| Gene name: | PFDN4 |
| Gene alias: | C1|PFD4 |
| Gene description: | prefoldin subunit 4 |
| Genbank accession: | NM_002623.3 |
| Immunogen: | PFDN4 (NP_002614.2, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES |
| Protein accession: | NP_002614.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PFDN4 expression in transfected 293T cell line by PFDN4 monoclonal antibody (M03), clone 2G4. Lane 1: PFDN4 transfected lysate (Predicted MW: 14.85 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |