| Brand: | Abnova |
| Reference: | H00005188-M01 |
| Product name: | PET112L monoclonal antibody (M01), clone 6B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PET112L. |
| Clone: | 6B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5188 |
| Gene name: | PET112L |
| Gene alias: | HSPC199|PET112 |
| Gene description: | PET112-like (yeast) |
| Genbank accession: | NM_004564 |
| Immunogen: | PET112L (NP_004555, 466 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS |
| Protein accession: | NP_004555 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PET112L monoclonal antibody (M01), clone 6B2 Western Blot analysis of PET112L expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |