| Brand: | Abnova |
| Reference: | H00005162-M03 |
| Product name: | PDHB monoclonal antibody (M03), clone 2B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PDHB. |
| Clone: | 2B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5162 |
| Gene name: | PDHB |
| Gene alias: | DKFZp564K0164|PHE1B |
| Gene description: | pyruvate dehydrogenase (lipoamide) beta |
| Genbank accession: | NM_000925 |
| Immunogen: | PDHB (NP_000916, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI |
| Protein accession: | NP_000916 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Proteomics of uveal melanomas suggests HSP-27 as a possible surrogate marker of chromosome 3 loss.Coupland SE, Vorum H, Mandal N, Kalirai H, Honore B, Urbak SF, Lake SL, Dopierala J, Damato B. Invest Ophthalmol Vis Sci. 2010 Jan;51(1):12-20. Epub 2009 Jul 30. |