Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDE7A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PDE7A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005150-A01 |
| Product name: | PDE7A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE7A. |
| Gene id: | 5150 |
| Gene name: | PDE7A |
| Gene alias: | HCP1|PDE7 |
| Gene description: | phosphodiesterase 7A |
| Genbank accession: | NM_002603 |
| Immunogen: | PDE7A (NP_002594, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDYNGQ |
| Protein accession: | NP_002594 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4(+) T cells.Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V. Mol Immunol. 2009 Nov 23. [Epub ahead of print] |