No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005130-M03 |
| Product name: | PCYT1A monoclonal antibody (M03), clone 7H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCYT1A. |
| Clone: | 7H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5130 |
| Gene name: | PCYT1A |
| Gene alias: | CT|CTPCT|PCYT1 |
| Gene description: | phosphate cytidylyltransferase 1, choline, alpha |
| Genbank accession: | NM_005017 |
| Immunogen: | PCYT1A (NP_005008, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS |
| Protein accession: | NP_005008 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | PCYT1A monoclonal antibody (M03), clone 7H8 Western Blot analysis of PCYT1A expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |