| Brand: | Abnova |
| Reference: | H00005122-M02 |
| Product name: | PCSK1 monoclonal antibody (M02), clone 3D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCSK1. |
| Clone: | 3D2 |
| Isotype: | IgG3 Kappa |
| Gene id: | 5122 |
| Gene name: | PCSK1 |
| Gene alias: | BMIQ12|NEC1|PC1|PC3|SPC3 |
| Gene description: | proprotein convertase subtilisin/kexin type 1 |
| Genbank accession: | NM_000439 |
| Immunogen: | PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN |
| Protein accession: | NP_000430 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |