Cart 14 Product Products 4 571,90 € (empty)
No products
265,00 € DAP Shipping
4 836,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 14 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 571,90 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 4 836,90 €
Data sheet of PCNA polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PCNA polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00005111-A02 |
| Product name: | PCNA polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCNA. |
| Gene id: | 5111 |
| Gene name: | PCNA |
| Gene alias: | MGC8367 |
| Gene description: | proliferating cell nuclear antigen |
| Genbank accession: | NM_002592 |
| Immunogen: | PCNA (NP_002583, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Protein accession: | NP_002583 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |