No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005110-M01 |
Product name: | PCMT1 monoclonal antibody (M01), clone 4G9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PCMT1. |
Clone: | 4G9 |
Isotype: | IgG2a Kappa |
Gene id: | 5110 |
Gene name: | PCMT1 |
Gene alias: | - |
Gene description: | protein-L-isoaspartate (D-aspartate) O-methyltransferase |
Genbank accession: | BC007501 |
Immunogen: | PCMT1 (AAH07501.1, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL |
Protein accession: | AAH07501.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (50.82 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | PCMT1 monoclonal antibody (M01), clone 4G9 Western Blot analysis of PCMT1 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |