Cart 12 Product Products 5 197,00 € (empty)
No products
To be determined Shipping
5 197,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 12 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 197,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 197,00 €
Data sheet of PCMT1 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PCMT1 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00005110-A02 |
| Product name: | PCMT1 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCMT1. |
| Gene id: | 5110 |
| Gene name: | PCMT1 |
| Gene alias: | - |
| Gene description: | protein-L-isoaspartate (D-aspartate) O-methyltransferase |
| Genbank accession: | NM_005389 |
| Immunogen: | PCMT1 (NP_005380, 117 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR |
| Protein accession: | NP_005380 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |