No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005097-M01 |
Product name: | PCDH1 monoclonal antibody (M01), clone 5D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH1. |
Clone: | 5D5 |
Isotype: | IgG1 Kappa |
Gene id: | 5097 |
Gene name: | PCDH1 |
Gene alias: | FLJ53887|MGC45991|PC42|PCDH42 |
Gene description: | protocadherin 1 |
Genbank accession: | NM_002587 |
Immunogen: | PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA |
Protein accession: | NP_002578 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification of PCDH1 as a Novel Susceptibility Gene for Bronchial Hyperresponsiveness.Koppelman GH, Meyers DA, Howard TD, Zheng SL, Hawkins GA, Ampleford EJ, Xu J, Koning H, Bruinenberg M, Nolte IM, van Diemen CC, Boezen HM, Timens W, Whittaker PA, Stine OC, Barton SJ, Holloway JW, Holgate ST, Graves PE, Martinez FD, van Oosterhout A, Blee Am J Respir Crit Care Med. 2009 Sep 3. [Epub ahead of print] |