| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005093-M01A |
| Product name: | PCBP1 monoclonal antibody (M01A), clone 1G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCBP1. |
| Clone: | 1G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5093 |
| Gene name: | PCBP1 |
| Gene alias: | HNRPE1|HNRPX|hnRNP-E1|hnRNP-X |
| Gene description: | poly(rC) binding protein 1 |
| Genbank accession: | BC039742 |
| Immunogen: | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
| Protein accession: | AAH39742 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01A), clone 1G2. Lane 1: PCBP1 transfected lysate(37.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |