Cart 4 Product Products 1 288,40 € (empty)
-
-
-
-
1 x CSDC2-cold...113,40 €
No products
To be determined Shipping
1 288,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 288,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 288,40 €
Data sheet of PCBP1 monoclonal antibody (M01), clone 1G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Tr |
More info about PCBP1 monoclonal antibody (M01), clone 1G2
| Brand: | Abnova |
| Reference: | H00005093-M01 |
| Product name: | PCBP1 monoclonal antibody (M01), clone 1G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCBP1. |
| Clone: | 1G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5093 |
| Gene name: | PCBP1 |
| Gene alias: | HNRPE1|HNRPX|hnRNP-E1|hnRNP-X |
| Gene description: | poly(rC) binding protein 1 |
| Genbank accession: | BC039742 |
| Immunogen: | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
| Protein accession: | AAH39742 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01), clone 1G2. Lane 1: PCBP1 transfected lysate(37.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | hnRNP E1 protects chromosomal integrity by translational regulation of Cdc27.Link LA, Howley BV, Hussey GS, Howe PH. Mol Cancer Res. 2016 Apr 21. [Epub ahead of print] |