Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00005093-M01 |
Product name: | PCBP1 monoclonal antibody (M01), clone 1G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCBP1. |
Clone: | 1G2 |
Isotype: | IgG2a Kappa |
Gene id: | 5093 |
Gene name: | PCBP1 |
Gene alias: | HNRPE1|HNRPX|hnRNP-E1|hnRNP-X |
Gene description: | poly(rC) binding protein 1 |
Genbank accession: | BC039742 |
Immunogen: | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
Protein accession: | AAH39742 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01), clone 1G2. Lane 1: PCBP1 transfected lysate(37.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | hnRNP E1 protects chromosomal integrity by translational regulation of Cdc27.Link LA, Howley BV, Hussey GS, Howe PH. Mol Cancer Res. 2016 Apr 21. [Epub ahead of print] |