PCBP1 monoclonal antibody (M01), clone 1G2 View larger

PCBP1 monoclonal antibody (M01), clone 1G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCBP1 monoclonal antibody (M01), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Tr

More info about PCBP1 monoclonal antibody (M01), clone 1G2

Brand: Abnova
Reference: H00005093-M01
Product name: PCBP1 monoclonal antibody (M01), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant PCBP1.
Clone: 1G2
Isotype: IgG2a Kappa
Gene id: 5093
Gene name: PCBP1
Gene alias: HNRPE1|HNRPX|hnRNP-E1|hnRNP-X
Gene description: poly(rC) binding protein 1
Genbank accession: BC039742
Immunogen: PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT
Protein accession: AAH39742
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005093-M01-13-15-1.jpg
Application image note: Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01), clone 1G2.

Lane 1: PCBP1 transfected lysate(37.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice
Publications: hnRNP E1 protects chromosomal integrity by translational regulation of Cdc27.Link LA, Howley BV, Hussey GS, Howe PH.
Mol Cancer Res. 2016 Apr 21. [Epub ahead of print]

Reviews

Buy PCBP1 monoclonal antibody (M01), clone 1G2 now

Add to cart