No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005093-A01 |
Product name: | PCBP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PCBP1. |
Gene id: | 5093 |
Gene name: | PCBP1 |
Gene alias: | HNRPE1|HNRPX|hnRNP-E1|hnRNP-X |
Gene description: | poly(rC) binding protein 1 |
Genbank accession: | BC039742 |
Immunogen: | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
Protein accession: | AAH39742 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PCBP1 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of PCBP1 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Post-Transcriptional Regulation of the Human Mu-Opioid Receptor (MOR) by Morphine-Induced RNA Binding Proteins hnRNP K and PCBP1.Song KY, Choi HS, Law PY, Wei LN, Loh HH. J Cell Physiol. 2016 Jun 13. [Epub ahead of print] |