| Brand: | Abnova |
| Reference: | H00005093-A01 |
| Product name: | PCBP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCBP1. |
| Gene id: | 5093 |
| Gene name: | PCBP1 |
| Gene alias: | HNRPE1|HNRPX|hnRNP-E1|hnRNP-X |
| Gene description: | poly(rC) binding protein 1 |
| Genbank accession: | BC039742 |
| Immunogen: | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
| Protein accession: | AAH39742 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCBP1 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of PCBP1 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Post-Transcriptional Regulation of the Human Mu-Opioid Receptor (MOR) by Morphine-Induced RNA Binding Proteins hnRNP K and PCBP1.Song KY, Choi HS, Law PY, Wei LN, Loh HH. J Cell Physiol. 2016 Jun 13. [Epub ahead of print] |