| Brand: | Abnova |
| Reference: | H00005092-M01 |
| Product name: | PCBD1 monoclonal antibody (M01), clone 1G11-H5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PCBD1. |
| Clone: | 1G11-H5 |
| Isotype: | IgG1 kappa |
| Gene id: | 5092 |
| Gene name: | PCBD1 |
| Gene alias: | DCOH|PCBD|PCD|PHS |
| Gene description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha |
| Genbank accession: | BC006324 |
| Immunogen: | PCBD1 (AAH06324, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Protein accession: | AAH06324 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCBD1 monoclonal antibody (M01), clone 1G11-H5 Western Blot analysis of PCBD1 expression in C32 ( Cat # L002V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |