PBX2 polyclonal antibody (A01) View larger

PBX2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PBX2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PBX2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005089-A01
Product name: PBX2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PBX2.
Gene id: 5089
Gene name: PBX2
Gene alias: G17|HOX12|PBX2MHC
Gene description: pre-B-cell leukemia homeobox 2
Genbank accession: NM_002586
Immunogen: PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Protein accession: NP_002577
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005089-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PBX2 polyclonal antibody (A01) now

Add to cart