Brand: | Abnova |
Reference: | H00005087-M01 |
Product name: | PBX1 monoclonal antibody (M01), clone 4A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PBX1. |
Clone: | 4A2 |
Isotype: | IgG2a Kappa |
Gene id: | 5087 |
Gene name: | PBX1 |
Gene alias: | DKFZp686B09108|MGC126627 |
Gene description: | pre-B-cell leukemia homeobox 1 |
Genbank accession: | NM_002585 |
Immunogen: | PBX1 (NP_002576, 213 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS |
Protein accession: | NP_002576 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.Cheung CL, Chan BY, Chan V, Ikegawa S, Kou I, Ngai H, Smith D, Luk KD, Huang QY, Mori S, Sham PC, Kung AW. Hum Mol Genet. 2009 Feb 15;18(4):679-87. Epub 2008 Dec 8. |