No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00005083-M03 |
Product name: | PAX9 monoclonal antibody (M03), clone 4B9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAX9. |
Clone: | 4B9 |
Isotype: | IgG2b Kappa |
Gene id: | 5083 |
Gene name: | PAX9 |
Gene alias: | - |
Gene description: | paired box 9 |
Genbank accession: | NM_006194 |
Immunogen: | PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH |
Protein accession: | NP_006185 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | PAX9 monoclonal antibody (M03), clone 4B9 Western Blot analysis of PAX9 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |