Cart 32 Product Products 12 712,40 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ZNF738-zin...113,40 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
12 712,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 32 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 712,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 712,40 €
Data sheet of PAX9 monoclonal antibody (M03), clone 4B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about PAX9 monoclonal antibody (M03), clone 4B9
| Brand: | Abnova |
| Reference: | H00005083-M03 |
| Product name: | PAX9 monoclonal antibody (M03), clone 4B9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAX9. |
| Clone: | 4B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5083 |
| Gene name: | PAX9 |
| Gene alias: | - |
| Gene description: | paired box 9 |
| Genbank accession: | NM_006194 |
| Immunogen: | PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH |
| Protein accession: | NP_006185 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PAX9 monoclonal antibody (M03), clone 4B9 Western Blot analysis of PAX9 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |