PAX9 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PAX9 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX9 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti

More info about PAX9 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005083-D01P
Product name: PAX9 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PAX9 protein.
Gene id: 5083
Gene name: PAX9
Gene alias: -
Gene description: paired box 9
Genbank accession: NM_006194.1
Immunogen: PAX9 (NP_006185.1, 1 a.a. ~ 341 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Protein accession: NP_006185.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005083-D01P-2-A3-1.jpg
Application image note: PAX9 MaxPab rabbit polyclonal antibody. Western Blot analysis of PAX9 expression in human stomach.
Applications: WB-Ti
Shipping condition: Dry Ice

Reviews

Buy PAX9 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart