PAX5 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005079-D01P
Product name: PAX5 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PAX5 protein.
Gene id: 5079
Gene name: PAX5
Gene alias: BSAP
Gene description: paired box 5
Genbank accession: NM_016734.1
Immunogen: PAX5 (NP_057953.1, 1 a.a. ~ 391 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Protein accession: NP_057953.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005079-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PAX5 expression in transfected 293T cell line (H00005079-T01) by PAX5 MaxPab polyclonal antibody.

Lane 1: PAX5 transfected lysate(42.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAX5 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart