No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00005071-M01 |
| Product name: | PARK2 monoclonal antibody (M01), clone 1H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PARK2. |
| Clone: | 1H4 |
| Isotype: | IgG3 Kappa |
| Gene id: | 5071 |
| Gene name: | PARK2 |
| Gene alias: | AR-JP|LPRS2|PDJ|PRKN |
| Gene description: | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
| Genbank accession: | BC022014 |
| Immunogen: | PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK |
| Protein accession: | AAH22014 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Regional and cellular localisation of Parkin Co-Regulated Gene in developing and adult mouse brain.Brody KM, Taylor JM, Wilson GR, Delatycki MB, Lockhart PJ. Brain Res. 2008 Mar 27;1201:177-86. Epub 2008 Jan 30. |