PARK2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PARK2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARK2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,PLA-Ce

More info about PARK2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005071-D01P
Product name: PARK2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PARK2 protein.
Gene id: 5071
Gene name: PARK2
Gene alias: AR-JP|LPRS2|PDJ|PRKN
Gene description: Parkinson disease (autosomal recessive, juvenile) 2, parkin
Genbank accession: BC022014.2
Immunogen: PARK2 (AAH22014.1, 1 a.a. ~ 387 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Protein accession: AAH22014.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005071-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PARK2 expression in transfected 293T cell line (H00005071-T01) by PARK2 MaxPab polyclonal antibody.

Lane 1: PARK2 transfected lysate(42.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy PARK2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart