Brand: | Abnova |
Reference: | H00005062-M01 |
Product name: | PAK2 monoclonal antibody (M01), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAK2. |
Clone: | 1E1 |
Isotype: | IgG1 Kappa |
Gene id: | 5062 |
Gene name: | PAK2 |
Gene alias: | PAK65|PAKgamma |
Gene description: | p21 protein (Cdc42/Rac)-activated kinase 2 |
Genbank accession: | NM_002577 |
Immunogen: | PAK2 (NP_002568, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE |
Protein accession: | NP_002568 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between CASP3 and PAK2. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-PAK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |